PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG000007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 221aa    MW: 24050.6 Da    PI: 7.5868
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG000007.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.87.8e-43681671100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i++lq+q++ l+a+la+++
  CCG000007.1  68 PCAACKILRRRCVEKCVLAPYFPPSEPYKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAISQLQKQVSDLQAQLAKAQ 165
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  CCG000007.1 166 AE 167
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.03967168IPR004883Lateral organ boundaries, LOB
PfamPF031958.5E-4368165IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MDMLQKTAAM SPIKAPSQFS CSPSSSSSPP SCHHSCPSTF PSTSKSNSPS LTSPSAATPP  60
PPPVVISPCA ACKILRRRCV EKCVLAPYFP PSEPYKFTIA HRVFGASNII KFLQELPESQ  120
RADAVSSMVY EASARIRDPV YGCAGAISQL QKQVSDLQAQ LAKAQAEVVN MQCQQANLVA  180
LLCMEMKQSQ QEPILQQHQY IDTSCFLDEN NLGASWEPLW T
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2841650.0HQ284165.1 Populus tremula x Populus alba lateral organ boundaries domain 1 (LBD1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011020741.11e-161PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB9HLY21e-136B9HLY2_POPTR; Uncharacterized protein
STRINGPOPTR_0008s04350.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-70LOB domain-containing protein 1